« Back
Home /
Recombinant Human Cyclic AMP-dependent transcription factor ATF-7(ATF7)

Recombinant Human Cyclic AMP-dependent transcription factor ATF-7(ATF7)

Item no.	CSB-EP002279HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Neuroscience Neural Lineage Markers Aging & Neurological Disorders Neural Signaling Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Activating transcription factor 7,Transcription factor ATF-A
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P17544
Gene Names	ATF7
Organism	Homo sapiens (Human)
AA Sequence	MGDDRPFVCNATGCGQRFTNEDHLAVHKHKHEMTL KFGPARTDSVIIADQTPTPTRFLKNCEEVGLFNEL ASSFEHEFKKAADEDEKKARSRTVAKKLVVFRPRL FLLCFGIIFLIG
Expression Region	1-117aa
Sequence Info	Full Length of BC042363
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40.3 kDa
Alternative Name(s)	Activating transcription factor 7 Transcription factor ATF-A
Relevance	Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family. Isoform 4 acts as a dominant repressor of the E-selectin/NF-ELAM1/delta-A promoter. Isoform 5 acts as a negative regulator, inhibiting both ATF2 and ATF7 transcriptional activities. It may exert these effects by sequestrating in the cytoplasm the Thr-53 phosphorylating kinase, preventing activation.
Reference	"ATF-a0, a novel variant of the ATF/CREB transcription factor family, forms a dominant transcription inhibitor in ATF-a heterodimers." Pescini R., Kaszubska W., Whelan J., DeLamarter J.F., Hooft van Huijsduijnen R. J. Biol. Chem. 269:1159-1165(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus
Subcellular Location	Nucleus, Nucleus, nucleoplasm
Protein Families	BZIP family
Tissue Specificity	Expressed in heart, lung and skeletal muscle. Isoform 4 is expressed in various tissues including heart, brain, placenta, lung and skeletal muscle. Highest levels in skeletal muscle. Lowest in lung and placenta.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP002279HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time