Item no. |
CSB-EP002279HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Activating transcription factor 7,Transcription factor ATF-A |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P17544 |
Gene Names |
ATF7 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MGDDRPFVCNATGCGQRFTNEDHLAVHKHKHEMTL KFGPARTDSVIIADQTPTPTRFLKNCEEVGLFNEL ASSFEHEFKKAADEDEKKARSRTVAKKLVVFRPRL FLLCFGIIFLIG |
Expression Region |
1-117aa |
Sequence Info |
Full Length of BC042363 |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
40.3 kDa |
Alternative Name(s) |
Activating transcription factor 7 Transcription factor ATF-A |
Relevance |
Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family. Isoform 4 acts as a dominant repressor of the E-selectin/NF-ELAM1/delta-A promoter. Isoform 5 acts as a negative regulator, inhibiting both ATF2 and ATF7 transcriptional activities. It may exert these effects by sequestrating in the cytoplasm the Thr-53 phosphorylating kinase, preventing activation. |
Reference |
"ATF-a0, a novel variant of the ATF/CREB transcription factor family, forms a dominant transcription inhibitor in ATF-a heterodimers." Pescini R., Kaszubska W., Whelan J., DeLamarter J.F., Hooft van Huijsduijnen R. J. Biol. Chem. 269:1159-1165(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus |
Subcellular Location |
Nucleus, Nucleus, nucleoplasm |
Protein Families |
BZIP family |
Tissue Specificity |
Expressed in heart, lung and skeletal muscle. Isoform 4 is expressed in various tissues including heart, brain, placenta, lung and skeletal muscle. Highest levels in skeletal muscle. Lowest in lung and placenta. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.