« Back
Home /
Recombinant Rat Artemin(Artn)

Recombinant Rat Artemin(Artn)

Item no.	CSB-EP002160RA-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Neuroscience
Target / Protein	Artn
Biologically active	Not Test
Expression system	E.coli
Species of origin	Rattus norvegicus (Rat)
Uniprot ID	Q6AYE8
AA Sequence	AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSD ELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSP PGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLS ATACGCLG
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	112-224aa
Protein length	Full Length of Mature Protein
MW	17.1 kDa
Relevance	Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue
References	"Artemin, a novel member of the GDNF ligand family, supports peripheral and central neurons and signals through the GFRalpha3-RET receptor complex." Baloh R.H., Tansey M.G., Lampe P.A., Fahrner T.J., Enomoto H., Simburger K.S., Leitner M.L., Araki T., Johnson E.M. Jr., Milbrandt J. Neuron 21:1291-1302(1998)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity).
Subcellular Location	Secreted
Protein Families	TGF-beta family, GDNF subfamily
Tissue Specificity	Cochlea. Expressed at higher level in sesorineural epithelium than in the modiolus region or substantia nigra.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time