Item no. |
CSB-EP001840HUe0-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Signal Transduction |
Uniprot ID |
P07355 |
Gene Names |
ANXA2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAE RDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDI AFAYQRRTKKELASALKSALSGHLETVILGLLKTP AQYDASELKASMKGLGTDEDSLIEIICSRTNQELQ EINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAK GRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRK EVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGK GTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLY YYIQQDTKGDYQKALLYLCGGDD |
Expression Region |
2-339aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
65.6 kDa |
Alternative Name(s) |
Annexin IIAnnexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV ; PAP-IVProtein Ip36 |
Relevance |
Calcium-regulated mbrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. |
Reference |
Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9 |
Subcellular Location |
Secreted, extracellular space, extracellular matrix, basement membrane, Melanosome |
Protein Families |
Annexin family |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.