« Back
Home /
Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)

Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)

Item no.	CSB-EP001176HU-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Adipocyte acid phosphatase,Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2),Red cell acid phosphatase 1
Available
Research Topic	Cell Biology
Uniprot ID	P24666
Gene Names	ACP1
Organism	Homo sapiens (Human)
AA Sequence	MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQN ISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP MSHVARQITKEDFATFDYILCMDESNLRDLNRKSN QVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE TVYQQCVRCCRAFLEKAH
Expression Region	1-158aa
Sequence Info	Full Length of Isoform 1
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	45 kDa
Alternative Name(s)	Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2) Red cell acid phosphatase 1
Relevance	Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Reference	"Human red cell acid phosphatase (ACP1). The amino acid sequence of the two isozymes Bf and Bs encoded by the ACP1*B allele." Dissing J., Johnsen A.H., Sensabaugh G.F. J. Biol. Chem. 266:20619-20625(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Subcellular Location	Cytoplasm
Protein Families	Low molecular weight phosphotyrosine protein phosphatase family
Tissue Specificity	T-lymphocytes express only isoform 2.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP001176HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time