Item no. |
CSB-CF856613HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Protein Wnt-13 |
Available |
|
Research Topic |
Stem Cells |
Uniprot ID |
Q93097 |
Gene Names |
WNT2B |
Organism |
Homo sapiens(Human) |
AA Sequence |
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRA SARLGLACLLLLLLLTLPARVDTSWWYIGALGARV ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIR ECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAA FVYAISSAGVVHAITRACSQGELSVCSCDPYTRGR HHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRL KDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGS CTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD GANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAA GSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKA EWLDQT |
Expression Region |
1-391aa |
Sequence Info |
Full Length |
Source |
in vitro E.coli expression system |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
59.8 kDa |
Alternative Name(s) |
Protein Wnt-13 |
Relevance |
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis. |
Reference |
"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis. |
Subcellular Location |
Secreted, extracellular space, extracellular matrix |
Protein Families |
Wnt family |
Tissue Specificity |
Isoform 1 is expressed in adult heart, brain, placenta, lung, prostate, testis, ovary, small intestine and colon. In the adult brain, it is mainly found in the caudate nucleus, subthalamic nucleus and thalamus. Also detected in fetal brain, lung and kidney. Isoform 2 is expressed in fetal brain, fetal lung, fetal kidney, caudate nucleus, testis and cancer cell lines. |
Paythway |
Hipposignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.