« Back
Home /
Recombinant Human Protein Wnt-2b(WNT2B)

Recombinant Human Protein Wnt-2b(WNT2B)

Item no.	CSB-CF856613HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein Wnt-13
Available
Research Topic	Stem Cells
Uniprot ID	Q93097
Gene Names	WNT2B
Organism	Homo sapiens(Human)
AA Sequence	MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRA SARLGLACLLLLLLLTLPARVDTSWWYIGALGARV ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIR ECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAA FVYAISSAGVVHAITRACSQGELSVCSCDPYTRGR HHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRL KDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGS CTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD GANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAA GSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKA EWLDQT
Expression Region	1-391aa
Sequence Info	Full Length
Source	in vitro E.coli expression system
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	59.8 kDa
Alternative Name(s)	Protein Wnt-13
Relevance	Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis.
Reference	"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Protein Families	Wnt family
Tissue Specificity	Isoform 1 is expressed in adult heart, brain, placenta, lung, prostate, testis, ovary, small intestine and colon. In the adult brain, it is mainly found in the caudate nucleus, subthalamic nucleus and thalamus. Also detected in fetal brain, lung and kidney. Isoform 2 is expressed in fetal brain, fetal lung, fetal kidney, caudate nucleus, testis and cancer cell lines.
Paythway	Hipposignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF856613HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time