« Back
Home /
Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM14(PAM18)

Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM14(PAM18)

Item no.	CSB-CF724558DIS
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	Q6BH37
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MAPFNMDIPTLAIPGDRNQSQAIELSQQAQQPQQP QQSQQAYTGHLQRKQADEGSAEYYF DKGCEWMGN HPWMTGMGVLGVAYFASGFVKSKQPGINGKAFVKG PFGQKMTPKEALQILN LKETNLSQAKLKEQHRKL MMANHPDKGGSSYLATKVNEAKDILEKRGGLKKK
Protein Names	Recommended name = Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s):Presequence translocated-associated motor subunit PAM18
Gene Names	Name:PAM18 Synonyms:TIM14 Ordered Locus Names: DEHA2G21648g
Expression Region	1-172
Sequence Info	full length protein
Species info	Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time