« Back
Home /
Recombinant Rhizobium meliloti Probable K(+)/H(+) antiporter subunit E(phaE)

Recombinant Rhizobium meliloti Probable K(+)/H(+) antiporter subunit E(phaE)

Item no.	CSB-CF703573RKU
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	Q52982
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MRTWFPYPLLSIALLLMWLLLSQSVTPGSIVLGLV VSTVLAWVTLNLQPARSRLHRWSRI AGFILRVVG DVIRSNIAVTLIILRAGRRPVNAGFMTVSLDLDDE NALALLACVVTATPGT AWLEYDRRQKILLFHVLD IENEDLWRKTITRYAADLKEIFE
Protein Names	Recommended name = Probable K(+)/H(+) antiporter subunit E Alternative name(s):pH adaptation potassium efflux system protein E Short name = Pha system subunit E
Gene Names	Name:phaE Synonyms:phaE1 Ordered Locus Names: R02913 ORF Names: SMc03182
Expression Region	1-161
Sequence Info	full length protein
Species info	Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time