« Back
Home /
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

Item no.	CSB-CF310446SVG
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	P87275
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MIEEKKELKKRRVLQMARFYGAAAFTLITMRLISR AIKVRKYVPSIFQQNYKLPPFSQRN EAMSALTYA SAASIGTFSTLIFGFCWALDISTAREFVFKTREFM SLPQALETDTSMDEET SKLTKQLQDLLSSENNK
Protein Names	Recommended name = Altered inheritance of mitochondria protein 11 Alternative name(s):Genetic interactor of prohibitins 8
Gene Names	Name:AIM11 Synonyms:GEP8 Ordered Locus Names: YER093C-A
Expression Region	1-137
Sequence Info	full length protein
Species info	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time