Item no. |
CSB-CF010882HUb2-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Neuroscience |
Uniprot NO. |
P28222 |
Gene Names |
HTR1B |
Source |
in vitro E.coli expression system |
Expression Region |
1-390aa |
Sequence |
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSA KDYIYQDSISLPWKVLLVMLLALITLATTLSNAFV IATVYRTRKLHTPANYLIASLAVTDLLVSILVMPI STMYTVTGRWTLGQVVCDFWLSSDITCCTASILHL CVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWV FSISISLPPFFWRQAKAEEEVSECVVNTDHILYTV YSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPN RTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSE SGSPVYVNQVKVRVSDALLEKKKLMAARERKATKT LGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI FDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIR FKCTS |
Protein Description |
Full Length |
Tag Info |
N-terminal 10xHis-SUMO-tagged |
Mol. Weight |
62.1 kDa |
Biological Activity |
Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 ug/ml can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml. |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Endotoxin |
Not test. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Alias |
S12 Serotonin 1D beta receptor |
Relevance |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances, such as lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Regulates the release of 5-hydroxytryptamine, dopamine and acetylcholine in the brain, and thereby affects neural activity, nociceptive processing, pain perception, mood and behavior. Besides, plays a role in vasoconstriction of cerebral arteries. |
Tag Information |
N-terminal 10xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.