Item no. |
CSB-CF008433HU(A4)-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Quantity options |
10ug
100ug
20ug
50ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Cell Biology |
Uniprot ID |
P25445 |
Gene Names |
FAS |
Organism |
Homo sapiens (Human) |
AA Sequence |
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKA HFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCK PNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKC KEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCR KHRKENQGSHESPTLNPETVAINLSDVDLSKYITT IAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDT AEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCT LAEKIQTIILKDITSDSENSNFRNEIQSLV |
Expression Region |
26-335aa |
Sequence Info |
Full Length of Mature Protein |
Source |
in vitro E.coli expression system |
Tag Info |
N-terminal 10xHis-tagged |
MW |
40.6 kDa |
Alternative Name(s) |
Apo-1 antigen (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD_antigen: CD95 APT1) (FAS1) (TNFRSF6) |
Relevance |
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). |
Reference |
The polypeptide encoded by the cDNA for human cell surface antigen Fas can mediate apoptosis. Itoh N., Yonehara S., Ishii A., Yonehara M., Mizushima S., Sameshima M., Hase A., Seto Y., Nagata S. Cell 66:233-243(1991) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). |
Involvement in disease |
Autoimmune lymphoproliferative syndrome 1A (ALPS1A) |
Subcellular Location |
Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted |
Tissue Specificity |
Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. |
Paythway |
MAPKsignalingpathway |
Tag Information |
N-terminal 10xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.