Item no. |
CSB-CF005472HU-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cytoplasmic linker-associated protein 2,Protein Orbit homolog 2,Short name:,hOrbit2 |
Available |
|
Research Areas |
Cell Biology |
Uniprot ID |
O75122 |
Gene Names |
CLASP2 |
Organism |
Homo sapiens(Human) |
AA Sequence |
MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKV PAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGA VDEDDFIKAFTDVPSIQIYSSRELEETLNKIREIL SDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHL RLLDGALKLSAKDLRSQVVREACITVAHLSTVLGN KFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFI IRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLL LQEWQTHSLERHAAVLVETIKKGIHDADAEARVEA RKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLK SSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANP STVAGRVSAGSSKASSLPGSLQRSRSDIDVNAAAG AKAHHAAGQSVRSGRLGAGALNAGSYASLECEAFW RSGRTAKLYSV |
Expression Region |
1-431aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
in vitro E.coli expression system |
Tag Info |
N-terminal 6xHis-B2M-tagged |
MW |
60.5 kDa |
Alternative Name(s) |
Cytoplasmic linker-associated protein 2 Protein Orbit homolog 2 Short name: hOrbit2 |
Relevance |
Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules (PubMed:26003921). Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2 (PubMed:16824950). This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle (PubMed:16866869, PubMed:16914514). Acts as a mediator of ERBB2-dependent stabilization of microtubules at the cell cortex. |
Reference |
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules |
Subcellular Location |
Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle, Golgi apparatus, Golgi apparatus, trans-Golgi network, Cell membrane, Cell projection, ruffle membrane |
Protein Families |
CLASP family |
Tissue Specificity |
Brain-specific. |
Tag Information |
N-terminal 6xHis-B2M-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.