« Back
Home /
Recombinant Neisseria meningitidis serogroup A / serotype 4A ATP synthase subunit b(atpF)

Recombinant Neisseria meningitidis serogroup A / serotype 4A ATP synthase subunit b(atpF)

Item no.	CSB-CF002358NGF
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	A1IPX1
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDE RAAKVAEGLAAAERGKSDFEQAEKKVAELLAEGRN QVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQA KADVEQELFRARESLREQVAVLAVKGAESILRSEV DASKHAKLLDTLKQEL
Protein Names	Recommended name = ATP synthase subunit b Alternative name(s):ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name = F-ATPase subunit b
Gene Names	Name:atpF Ordered Locus Names: NMA0515
Expression Region	1-156
Sequence Info	full length protein
Species info	Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time