« Back
Home /
Recombinant Human Aquaporin-1(AQP1)

Recombinant Human Aquaporin-1(AQP1)

Item no.	CSB-CF001957HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot ID	P29972
Gene Names	AQP1
Alternative Name(s)	Aquaporin-CHIP Urine water channel Water channel protein for red blood cells and kidney proximal tubule
AA Sequence	ASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFK YPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHIS GAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAI VATAILSGITSSLTGNSLGRNDLADGVNSGQGLGI EIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSV ALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWI FWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWT SGQVEEYDLDADDINSRVEMKPK
Source	in vitro E.coli expression system
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	2-269aa
MW of Fusion Proten	44, 4
Sequence Info	Full Length
Relevance	Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Reference	"Characterization of the 3' UTR sequence encoded by the AQP-1 gene in human retinal pigment epithelium."Ruiz A.C., Bok D.Biochim. Biophys. Acta 1282:174-178(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time