« Back
Home /
Recombinant Human Actin-like protein 8(ACTL8)

Recombinant Human Actin-like protein 8(ACTL8)

Item no.	CSB-BP887982HU-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Signal Transduction
Uniprot ID	Q9H568
Gene Names	ACTL8
Organism	Homo sapiens (Human)
AA Sequence	MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNY LPCKENPGPSYARRRVSLGIDICHPDTFSYPIERG RILNWEGVQYLWSFVLENHRREQEVPPVIITETPL REPADRKKMLEILFELLHVPSVLLADQLQMSLYAS GLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEF AGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMN KCYVPQNLGEALDFRERQQSALDESNTYQLPDGSR VELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESV ESCEISLRPLLVSHVMACGGNTLYPGFTKRLFREL MGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTY QSEWMSREEYGEHMRM
Expression Region	1-366aa
Sequence Info	Full Length
Source	Baculovirus
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	45.4 kDa
Alternative Name(s)	Cancer/testis antigen 57 (CT57)
Reference	"A human interactome in three quantitative dimensions organized by stoichiometries and abundances." Hein M.Y., Hubner N.C., Poser I., Cox J., Nagaraj N., Toyoda Y., Gak I.A., Weisswange I., Mansfeld J., Buchholz F., Hyman A.A., Mann M. Cell 163:712-723(2015)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Cytoplasm, cytoskeleton
Protein Families	Actin family
Tissue Specificity	Strongly expressed in testis and pancreas. Weak expression in placenta.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time