Item no. |
CSB-BP885798HU-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Baculovirus-Infected Insect Cells |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
p21-activated kinase 5,Short name:,PAK-5,p21-activated kinase 7,Short name:,PAK-7 |
Available |
|
Research Topic |
Cancer |
Uniprot ID |
Q8TB93 |
Gene Names |
PAK7 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGL PQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTI VRGNKPCKETSINGLLEDFDNISVTRSNSLRKESP PTPDQGASSHGPGHAEENGFITFSQYSSESDTTAD YTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKM KHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPS EYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGC SKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQP TMRQRSRSGSGLQ |
Expression Region |
1-293aa |
Sequence Info |
Partial |
Source |
Baculovirus |
Tag Info |
N-terminal 6xHis-tagged |
MW |
34.9 kDa |
Alternative Name(s) |
p21-activated kinase 5 Short name: PAK-5 p21-activated kinase 7 Short name: PAK-7 |
Relevance |
Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions. |
Reference |
"p21-Activated kinase 5 (Pak5) localizes to mitochondria and inhibits apoptosis by phosphorylating BAD."Cotteret S., Jaffer Z.M., Beeser A., Chernoff J.Mol. Cell. Biol. 23:5526-5539(2003) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.