« Back
Home /
Recombinant Human Complement C1q tumor necrosis factor-related protein 3(C1QTNF3)

Recombinant Human Complement C1q tumor necrosis factor-related protein 3(C1QTNF3)

Item no.	CSB-BP883621HU-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Metabolism
Uniprot ID	Q9BXJ4
Gene Names	C1QTNF3
Organism	Homo sapiens (Human)
AA Sequence	QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPG PPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDL GPRGERGQHGPKGEKGYPGIPPELQIAFMASLATH FSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGV YFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEM KGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQ RFSTFAGFLLFETK
Expression Region	23-246aa
Sequence Info	Full Length of Mature Protein
Source	Baculovirus
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	28.1 kDa
Alternative Name(s)	Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26 ) (CTRP3)
Reference	"Effects of the new C1q/TNF-related protein (CTRP-3) "cartonectin" on the adipocytic secretion of adipokines." Wolfing B., Buechler C., Weigert J., Neumeier M., Aslanidis C., Schoelmerich J., Schaffler A. Obesity (Silver Spring) 16:1481-1486(2008)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Secreted
Tissue Specificity	Expressed in colon and small intestine.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time