« Back
Home /
Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Item no.	CSB-BP856932HUb0-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Signal Transduction
Target / Protein	PELI1
Biologically active	Not Test
Expression system	Baculovirus
Species of origin	Homo sapiens (Human)
Uniprot ID	Q96FA3
AA Sequence	MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRG RRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRS TESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKT SDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLID LCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVH GYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLP HGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
Tag Info	N-terminal 10xHis-tagged
Expression Region	1-418aa
Protein length	Full Length
MW	48.8 kDa
Alternative Name(s)	Pellino-related intracellular-signaling molecule (RING-type E3 ubiquitin transferase pellino homolog 1) (Pellino-1) (PRISM)
Relevance	E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
References	"Pellino-1, an adaptor protein of interleukin-1 receptor/toll-like receptor signaling, is sumoylated by Ubc9." Kim J.H., Sung K.S., Jung S.M., Lee Y.S., Kwon J.Y., Choi C.Y., Park S.H. Mol. Cells 31:85-89(2011)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
Protein Families	Pellino family
Tag Information	N-terminal 10xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time