« Back
Home /
Recombinant Lithobates catesbeiana Saxiphilin ,partial

Recombinant Lithobates catesbeiana Saxiphilin ,partial

Item no.	CSB-BP339158LQA(A5)-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Baculovirus-Infected Insect Cells
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,SAX
Available
Research Areas	Others
Uniprot ID	P31226
Gene Names	N/A
Organism	Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
AA Sequence	AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIAC TEASCPKGCVKQILKGEADAVKLEVQYMYEALMCG LLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVAL VKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSL IRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGD PKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVA FVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDG SRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIV ANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQ CLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSS ELISACTIKHC
Expression Region	484-844aa
Sequence Info	Partial
Source	Baculovirus
Tag Info	C-terminal 9xHis-tagged
MW	41.7 kDa
Alternative Name(s)	Short name: SAX
Relevance	Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Reference	Molecular cloning of bullfrog saxiphilin: a unique relative of the transferrin family that binds saxitoxin.Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Subcellular Location	Secreted
Protein Families	Transferrin family
Tissue Specificity	Plasma. Highest levels of transcripts found in the liver, the lung, the pancreas and the brain.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time