« Back
Home /
Recombinant Human Peroxisome proliferator-activated receptor alpha(PPARA)

Recombinant Human Peroxisome proliferator-activated receptor alpha(PPARA)

Item no.	CSB-BP018421HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Cancer
Uniprot ID	Q07869
Gene Names	PPARA
Organism	Homo sapiens (Human)
AA Sequence	MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQ EISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD TLSPASSPSSVTYPVVPGSVDESPSGALNIECRIC GDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD RSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGR MPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI YEAYLKNFNMNKVKARVILSGKASNNPPFVIHDME TLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTS VETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYE AIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICC GDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAA LHPLLQEIYRDMY
Expression Region	1-468aa
Sequence Info	Full Length
Source	Baculovirus
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	56.2 kDa
Alternative Name(s)	Nuclear receptor subfamily 1 group C member 1 (NR1C1) (PPAR)
Relevance	Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2.
Reference	"Human and rat peroxisome proliferator activated receptors (PPARs) demonstrate similar tissue distribution but different responsiveness to PPAR activators." Mukherjee R., Jow L., Noonan D., McDonnell D.P. J. Steroid Biochem. Mol. Biol. 51:157-166(1994)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16
Subcellular Location	Nucleus
Protein Families	Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity	Skeletal muscle, liver, heart and kidney.
Paythway	cAMPsignalingpathway
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time