Item no. |
CSB-BP018421HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Conjugate/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Cancer |
Uniprot ID |
Q07869 |
Gene Names |
PPARA |
Organism |
Homo sapiens (Human) |
AA Sequence |
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQ EISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD TLSPASSPSSVTYPVVPGSVDESPSGALNIECRIC GDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD RSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGR MPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI YEAYLKNFNMNKVKARVILSGKASNNPPFVIHDME TLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTS VETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYE AIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICC GDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAA LHPLLQEIYRDMY |
Expression Region |
1-468aa |
Sequence Info |
Full Length |
Source |
Baculovirus |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
56.2 kDa |
Alternative Name(s) |
Nuclear receptor subfamily 1 group C member 1 (NR1C1) (PPAR) |
Relevance |
Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2. |
Reference |
"Human and rat peroxisome proliferator activated receptors (PPARs) demonstrate similar tissue distribution but different responsiveness to PPAR activators." Mukherjee R., Jow L., Noonan D., McDonnell D.P. J. Steroid Biochem. Mol. Biol. 51:157-166(1994) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16 |
Subcellular Location |
Nucleus |
Protein Families |
Nuclear hormone receptor family, NR1 subfamily |
Tissue Specificity |
Skeletal muscle, liver, heart and kidney. |
Paythway |
cAMPsignalingpathway |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.