« Back
Home /
Recombinant Human Aspartoacylase(ASPA)

Recombinant Human Aspartoacylase(ASPA)

Item no.	CSB-BP002223HU-100
Manufacturer	Cusabio
Amount	100ug
Quantity options	1mg 10ug 100ug 20ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Signal Transduction
Target / Protein	ASPA
Biologically Active	Not Test
Expression System	Baculovirus
Species of origin	Homo sapiens (Human)
Uniprot ID	P45381
AA Sequence	MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWL ENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDS EDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPV GIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHP NLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	1-313aa
Protein Length	Full Length
MW	39.7 kDa
Alternative Name(s)	Aminoacylase-2 Short name:ACY-2 ACY2, ASP
Relevance	Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.
Reference	Examination of the mechanism of human brain aspartoacylase through the binding of an intermediate analogue. Le Coq J., Pavlovsky A., Malik R., Sanishvili R., Xu C., Viola R.E. Biochemistry 47:3484-3492(2008)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.
Involvement in disease	Canavan disease (CAND)
Subcellular Location	Cytoplasm, Nucleus
Protein Families	AspA/AstE family, Aspartoacylase subfamily
Tissue Specificity	Brain white matter, skeletal muscle, kidney, adrenal glands, lung and liver.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time