« Back
Home /
Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11)

Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11)

Item no.	CSB-CF023986MO
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	O35235
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPS APAPAPPPAASRSMFLALLGLGLGQVVCSIALFLY FRAQMDPNRISEDSTHCFYRILRLHENADLQDSTL ESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFS GAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIP SGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQD GFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTS IKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFF KLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDI
Protein Names	Recommended name = Tumor necrosis factor ligand superfamily member 11 Alternative name(s):Osteoclast differentiation factor Short name = ODF Osteoprotegerin ligand Short name = OPGL Receptor activator of nuclear factor kappa-B ligand Short name = RANKL TNF-related activation-induced cytokine Short name = TRANCE CD_antigen = CD254 Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 11, membrane form 2. Tumor necrosis factor ligand superfamily member 11, soluble form
Gene Names	Name:Tnfsf11 Synonyms:Opgl, Rankl, Trance
Expression Region	1-316
Sequence Info	full length protein
Species info	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time