« Back
Home /
Recombinant Mouse Interleukin-13(Il13)

Recombinant Mouse Interleukin-13(Il13)

Item no.	CSB-AP004741MO-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Classification	Cytokine
Subdivision	Interleukin
Research Areas	Immunology
Uniprot NO.	P20109
Gene Names	Il13
Source	E.coli
Expression Region	22-131aa
Sequence	PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMV WSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHG LCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLF RHGPF
Protein Description	Full Length of Mature Protein
Tag Info	Tag-Free
Mol. Weight	12.2 kDa
Biological Activity	The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias	Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13
Relevance	Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Ralpha1 with low affinity and triggers association of IL4Ralpha, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Ralpha2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.
Function	Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages
Subcellular Location	Secreted
Protein Families	IL-4/IL-13 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

not available