Item no. |
CSB-AP004251MO-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Lyophilized powder |
Specific against |
Mouse |
Purity |
Greater than 95% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Classification |
Cytokine |
Subdivision |
Interferon |
Research Areas |
Immunology |
Uniprot NO. |
Q8BVZ5 |
Gene Names |
Il33 |
Source |
E.coli |
Expression Region |
109-266aa |
Sequence |
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVIN VDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKK LMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPE QAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLAL VEEKDESCNNIMFKLSKI |
Protein Description |
Partial |
Tag Info |
Tag-Free |
Mol. Weight |
17.6 kDa |
Biological Activity |
The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 ug/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml. |
Purity |
Greater than 95% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alias |
Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11 |
Relevance |
Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up?regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL?1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs. |
Function |
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; FUNCTION |
Subcellular Location |
Nucleus, Chromosome, Cytoplasmic vesicle, secretory vesicle, Secreted |
Protein Families |
IL-1 family |
Tag Information |
Tag-Free |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.