« Back
Home /
Recombinant Human Polypeptide N-acetylgalactosaminyltransferase 14(GALNT14)

Recombinant Human Polypeptide N-acetylgalactosaminyltransferase 14(GALNT14)

Item no.	CSB-EP836212HU-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Polypeptide GalNAc transferase 14 ;GalNAc-T14 ;pp-GaNTase 14Protein-UDP acetylgalactosaminyltransferase 14UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14
Available
Research Topic	Metabolism
Uniprot ID	Q96FL9
Gene Names	GALNT14
Organism	Homo sapiens (Human)
AA Sequence	MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPT GPEVQTPKPSDADWDDLWDQFDERRYLNAKKWRVG DDPYKLYAFNQRESERISSNRAIPDTRHLRCTLLV YCTDLPPTSIIITFHNEARSTLLRTIRSVLNRTPT HLIREIILVDDFSNDPDDCKQLIKLPKVKCLRNNE RQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQ PLLHRVKEDYTRVVCPVIDIINLDTFTYIESASEL RGGFDWSLHFQWEQLSPEQKARRLDPTEPIRTPII AGGLFVIDKAWFDYLGKYDMDMDIWGGENFEISFR VWMCGGSLEIVPCSRVGHVFRKKHPYVFPDGNANT YIKNTKRTAEVWMDEYKQYYYAARPFALERPFGNV ESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQ KGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGE DAKSQVWAFTYTQQILQEELCLSVITLFPGAPVVL VLCKNGDDRQQWTKTGSHIEHIASHLCLDTDMFGD GTENGKEIVVNPCESSLMSQHWDMVSS
Expression Region	1-552aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	80.3 kDa
Alternative Name(s)	Polypeptide GalNAc transferase 14 ; GalNAc-T14 ; pp-GaNTase 14Protein-UDP acetylgalactosaminyltransferase 14UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14
Relevance	Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney.
Reference	Cloning and characterization of a novel UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, pp-GalNAc-T14.Wang H., Tachibana K., Zhang Y., Iwasaki H., Kameyama A., Chen L., Guo J.-M., Hiruma T., Togayachi A., Kudo T., Kikuchi N., Narimatsu H.Biochem. Biophys. Res. Commun. 300:738-744(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney.
Subcellular Location	Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families	Glycosyltransferase 2 family, GalNAc-T subfamily
Tissue Specificity	Detected in renal tubules (at protein level). Highly expressed in fetal and adult kidney. Widely expressed at low level. Weakly expressed in whole brain, cerebellum, thymus, lung, mammary gland, liver, stomach, small intestine, colon, pancreas, spleen, bladder, uterus, placenta, testis, ovary, skeletal muscle, leukocyte, B-cell, bone marrow, fetal brain, fetal thymus, fetal lung, fetal liver, fetal small intestine, fetal spleen, fetal skeletal and fetus. Detected in renal tubules (at protein level).
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP836212HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time