« Back
Home /
Recombinant human Insulin

Recombinant human Insulin

Item no.	CSB-EP011742HU(F)-1
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot ID	P01308
Gene Names	INS
AA sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAE DLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQ CCTSICSLYQLENYCN
Tag Info	His-SUMO-tag
Expression Region	25-110aa
MW	25.4kD
Sequence Info	Full length
Research area	Metabolism

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time