« Back
Home /
Recombinant Human Thioredoxin(TXN) (Active)

Recombinant Human Thioredoxin(TXN) (Active)

Item no.	CSB-AP005541HU-10
Manufacturer	Cusabio
Amount	10ug
Quantity options	1mg 10ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human
Purity	Greater than 95% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Classification	Other Recombinant Protein
Subdivision	Others
Research Areas	Signal Transduction
Uniprot NO.	P10599
Gene Names	TXN
Source	E.coli
Expression Region	1-105aa
Sequence	MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPC KMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Protein Description	Full Length
Tag Info	N-terminal 6xHis-tagged
Mol. Weight	13.9 kDa
Biological Activity	Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias	Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1
Relevance	Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.
Function	Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION
Subcellular Location	Nucleus, Cytoplasm, Secreted
Protein Families	Thioredoxin family
Paythway	NOD-likereceptorsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time