« Back
Home /
Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11),partial (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11),partial (Active)

Item no.	CSB-AP004851HU-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human
Conjugate/Tag	Tag Free
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Classification	Cytokine
Subdivision	Tumor Necrosis Factor
Research Areas	Cancer
Uniprot NO.	O14788
Gene Names	TNFSF11
Source	E.coli
Expression Region	140-317aa
Sequence	IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATD IPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVN QDGFYYLYANICFRHHETSGDLATEYLQLMVYVTK TSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGG FFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVR DID
Protein Description	Partial
Tag Info	N-terminal 6xHis-tagged
Mol. Weight	22.4 kDa
Biological Activity	The ED50 as determined by its ability to binding SF11A used funtional ELISA is less than 10 ug/ml.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Alias	CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11
Relevance	CD254, also known as RANKL, TNFSF11, TRANCE, OPGL and ODF, is a type II membrane protein of the tumor necrosis factor (TNF) superfamily, and affects the immune system and control bone regeneration and remodeling. RANKL is the ligand of nuclear factor (NF)-kappaB (RANK). When RANKL binds to RANK, it will undergo trimerization and then bind to an adaptor molecule TNF receptor-associated factor 6 (TRAF6). This results in the activation of several downstream signaling cascades, including the NFkappaB, mitogen-activated protein kinases (MAPK), activating protein 1 (AP-1), and nuclear factor of activated T cells (NFATc1), resulting in the formation of multinucleated bone-resorbing osteoclasts. RANKL is widely expressed in skeletal muscle, thymus, liver, colon, small intestine, adrenal gland, osteoblast, mammary gland epithelial cells, prostate and pancreas.
Function	Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy
Involvement in disease	Osteopetrosis, autosomal recessive 2 (OPTB2)
Subcellular Location	Isoform 1: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted
Protein Families	Tumor necrosis factor family
Tissue Specificity	Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
Paythway	NF-kappaBsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time