« Back
Home /
Recombinant Human Interferon alpha-2(IFNA2)

Recombinant Human Interferon alpha-2(IFNA2)

Item no.	CSB-AP004211HU-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Classification	Cytokine
Subdivision	Interferon
Research Areas	Immunology
Uniprot NO.	P01563
Gene Names	IFNA2
Source	E.coli
Expression Region	24-188aa
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHD FGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTK DSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGV TETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE
Protein Description	Full Length of Mature Protein
Tag Info	Tag-Free
Mol. Weight	19.24 kDa
Biological Activity	The ED50 as determined by a viral resistance assay using VSV-WISH cells is typically 10 pg/mL.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias	Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2
Relevance	At least 23 different variants of IFN-alpha are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-alpha subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Function	Produced by macrophages, IFN-alpha have antiviral activities.
Subcellular Location	Secreted
Protein Families	Alpha/beta interferon family
Paythway	Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

not available