Item no. |
CSB-MP001392HU(M)-100ug |
Manufacturer |
Cusabio
|
Amount |
100 ug |
Quantity options |
100 ug
1 mg
20 ug
|
Type |
Proteins Recombinant |
Format |
Lyophilized powder |
Specific against |
Human (Homo sapiens) |
Conjugate/Tag |
HIS |
Purity |
The purity information is not available for VLPs proteins. |
Sequence |
MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTG |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Beta-2 adrenoreceptor;Beta-2 adrenoceptor |
Available |
|
Manufacturer - Category |
MP-VLP Transmembrane Protein & Developed Protein |
Manufacturer - Conjugate / Tag |
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions) |
Storage Conditions |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Molecular Weight |
47.8 kDa |
Buffer |
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4. |
General Research Areas |
Cardiovascular |
Relevance |
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. |
Expression Region |
1-413aa(G16R, E27Q) |
Protein Length |
Full Length |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. |
Notes |
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant). |
Gene Names |
ADRB2 |
Transmembrane Domain |
7TM |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.