« Back
Home /
Anti-IRF7 Antibody

Anti-IRF7 Antibody

Manufacturer	Boster
Category	Antibodies Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Polyclonal
Specific against	Human, Mouse, Rat
Format	Lyophilized
Applications	WB, IHC
Amount	100 ug/vial
Host	Rabbit
Item no.	BOS-A00115-1
eClass 6.1	32160702
eClass 9.0	32160702
Available
Alias	Interferon regulatory factor 7;IRF-7;IRF7;
Background	Interferon regulatory factor 7, also known as IRF7, is a member of the interferon regulatory factor family of transcription factors. This gene is mapped to 11p15.5. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established.
Concentration	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Cross reactivity	No cross reactivity with other proteins
Description	Rabbit IgG polyclonal antibody for Interferon regulatory factor 7(IRF7) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Gene full name	Interferon regulatory factor 7
Gene name	IRF7
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human IRF7 (31-67aa QWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVAR), different from the related mouse sequence by seven amino acids.
MW	54278 MW
Protein function	Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses. Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction via both the virus-activated, MyD88- independent pathway and the TLR-activated, MyD88-dependent pathway. Required during both the early and late phases of the IFN gene induction but is more critical for the late than for the early phase. Exists in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, becomes phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization where along with other coactivators it can activate transcription of the type I IFN and ISG genes. Can also play a role in regulating adaptive immune responses by inducing PSMB9/LMP2 expression, either directly or through induction of IRF1. Binds to the Q promoter (Qp) of EBV nuclear antigen 1 a (EBNA1) and may play a role in the regulation of EBV latency. Can activate distinct gene expression programs in macrophages and regulate the anti-tumor properties of primary macrophages.
Protein name	Interferon regulatory factor 7
Purification	Immunogen affinity purified.
Recommended detection ystems	Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Research category	\|immunology\|innate immunity\|cytokines\|interferons\| microbiology\|interspecies interaction\|host virus interaction\| epigenetics and nuclear signaling\|transcription\|domain families\|hlh / leucine zipper\|helix-turn-helix\|polymerase associated factors\|pol ii transcription\| immunology\|immune system diseases\|antiviral signaling\|tlr signaling
Storage	At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time.Avoid repeated freezing and thawing.
Subcellular localization	Nucleus. Cytoplasm. The phosphorylated and active form accumulates selectively in the nucleus.
Tissue specificity	Expressed predominantly in spleen, thymus and peripheral blood leukocytes.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug/vial

not available