« Back
Home /
Recombinant Brugia malayi Protein JTB (JTB), partial

Recombinant Brugia malayi Protein JTB (JTB), partial

Item no.	BM-RPC21548-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Worm
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	O77049
Gene Name	JTB
Source	E.coli
Expression Region	31-105aa
AA Sequence	EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSN FQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSAL MERHL
Sequence Info	Extracellular Domain
Tag	N-terminal 6x His-SUMO Tag
Theoretical MW	24.4 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/27/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail