« Back
Home /
Recombinant Moloney murine leukemia virus Gag polyprotein (gag), partial

Recombinant Moloney murine leukemia virus Gag polyprotein (gag), partial

Item no.	BM-RPC20279-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Oncology Metabolism Diabetes Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins
Specific against	Viral
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Core polyprotein, Cleaved into the following 4 chains:, Matrix protein p15, Short name:, MA, RNA-binding phosphoprotein p12, Alternative name(s):, pp12, Capsid protein p30, Short name:, CA, Nucleocapsid protein p10, Short name:, NC-gag
Available
UniProt ID	P03332
Gene Name	gag
Alternative Names	Core polyprotein, Cleaved into the following 4 chains:, Matrix protein p15, Short name:, MA, RNA-binding phosphoprotein p12, Alternative name(s):, pp12, Capsid protein p30, Short name:, CA, Nucleocapsid protein p10, Short name:, NC-gag
Source	E.coli
Expression Region	216-478aa
AA Sequence	PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPG KLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQR VLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWD YTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVK GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQE TNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVR EAEKIFNKRETPEEREERIRRETEEKEERRRTEDE QKEKERDRRRHREMSKLL
Sequence Info	Partial
Tag	N-terminal 6xHis-SUMO-tagged
Theoretical MW	46.59kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 16 days

Compare

Add to wishlist

Recommend by mail