« Back
Home /
Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5)

Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5)

Item no.	BM-RPC20417-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Metabolism
Type	Proteins
Specific against	Porcine
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Epididymis-specific glutathione peroxidase-like protein, Short name:EGLP
Available
UniProt ID	O18994
Gene Name	GPX5
Alternative Names	Epididymis-specific glutathione peroxidase-like protein, Short name:EGLP
Source	E.coli
Expression Region	22-219aa
AA Sequence	NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQ YAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFG LVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGY VPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELI GSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRW VHETPISTVKSDILAYLKQFKTE
Sequence Info	Full Length of Mature Protein
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	26.78kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/30/2024

Express Delivery: Save 21 days

Compare

Add to wishlist

Recommend by mail