« Back
Home /
Recombinant Escherichia coli 50S ribosomal protein L31 (rpmE)

Recombinant Escherichia coli 50S ribosomal protein L31 (rpmE)

Item no.	BM-RPC24193-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Hepatic Cancer
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	P0A7M9
Gene Name	rpmE
Source	E.coli
Expression Region	1-70aa
AA Sequence	MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLD VCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK
Sequence Info	Full Length
Tag	N-terminal GST Tag
Theoretical MW	34.9 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/27/2024

Express Delivery: Save 21 days

Compare

Add to wishlist

Recommend by mail