« Back
Home /
Recombinant Raphanus sativus Defensin-like protein 2 (AFP2)

Recombinant Raphanus sativus Defensin-like protein 2 (AFP2)

Item no.	BM-RPC20365-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cysteine-rich antifungal protein 2, Short name:, AFP2, Short name:, RAFP2
Available
UniProt ID	P30230
Gene Name	AFP2
Alternative Names	Cysteine-rich antifungal protein 2, Short name:, AFP2, Short name:, RAFP2
Source	E.coli
Expression Region	30-80aa
AA Sequence	QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGS CNYVFPAHKCICYFPC
Sequence Info	Full Length
Tag	N-terminal 6xHis-SUMO-tagged
Theoretical MW	21.61kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/30/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail