« Back
Home /
Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial

Item no.	BM-RPC20160-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor necrosis factor C , TNF-CTumor necrosis factor ligand superfamily member 3
Available
UniProt ID	Q862Z7
Gene Name	LTB
Alternative Names	Tumor necrosis factor C , TNF-CTumor necrosis factor ligand superfamily member 3
Source	E.coli
Expression Region	49-244aa
AA Sequence	QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDL SPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQ FSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQ GRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPV LDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNI SHPDMVDFARGKTFFGAVMVG
Sequence Info	Extracellular Domain
Tag	N-terminal 6xHis-SUMO-tagged
Theoretical MW	36.7kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 8/30/2024