« Back
Home /
Recombinant Human Neural cell adhesion molecule L1 protein (L1CAM), partial

Recombinant Human Neural cell adhesion molecule L1 protein (L1CAM), partial

Item no.	BM-RPC24146-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	P32004
Gene Name	L1CAM
Alternative Names	CD171
Source	E.coli
Expression Region	1003-1114aa
AA Sequence	EAIVREGGTMALSGISDFGNISATAGENYSVVSWV PKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQ SSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGT GRVRLPP
Sequence Info	Partial Length
Tag	N-terminal 6x His Tag
Theoretical MW	16.5 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/27/2024

Express Delivery: Save 21 days

Compare

Add to wishlist

Recommend by mail