« Back
Home /
Recombinant Human C-C motif chemokine 20 (CCL20), partial

Recombinant Human C-C motif chemokine 20 (CCL20), partial

Item no.	BM-RPC24098-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	P78556
Gene Name	CCL20
Alternative Names	Beta-chemokine exodus-1CC chemokine LAR; CLiver and activation-regulated chemokine; Macrophage inflammatory protein 3 alpha; MIP-3-alpha; Small-inducible cytokine A20
Source	E.coli
Expression Region	27-95aa
AA Sequence	ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDIN AIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN
Sequence Info	Full Length
Tag	N-terminal GST Tag
Theoretical MW	34.9 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/30/2024

Express Delivery: Save 15 days

Compare

Add to wishlist

Recommend by mail