« Back
Home /
Recombinant Human DNA-directed RNA polymerase I subunit RPA12 (ZNRD1)

Recombinant Human DNA-directed RNA polymerase I subunit RPA12 (ZNRD1)

Item no.	BM-RPC23704-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	Q9P1U0
Gene Name	ZNRD1
Alternative Names	Zinc ribbon domain-containing protein 1
Source	E.coli
Expression Region	1-126aa
AA Sequence	MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDT VTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSA DEGQTVFYTCTNCKFQEKEDS
Sequence Info	Full Length
Tag	N-terminal 6x His-SUMO Tag
Theoretical MW	29.9 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 14 days

Compare

Add to wishlist

Recommend by mail