« Back
Home /
Recombinant Human Prostaglandin-H2 D-isomerase (PTGDS)

Recombinant Human Prostaglandin-H2 D-isomerase (PTGDS)

Item no.	BM-RPC20067-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Enzymes Prostaglandin Synthases
Type	Proteins
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-trace protein, Cerebrin-28Glutathione-independent PGD synthaseLipocalin-type prostaglandin-D synthaseProstaglandin-D2 synthase , PGD2 synthase , PGDS , PGDS2
Available
UniProt ID	P41222
Gene Name	PTGDS
Alternative Names	Beta-trace protein, Cerebrin-28Glutathione-independent PGD synthaseLipocalin-type prostaglandin-D synthaseProstaglandin-D2 synthase , PGD2 synthase , PGDS , PGDS2
Source	E.coli
Expression Region	23-190aa
AA Sequence	APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLRE KKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETR TMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQ YALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEK FTAFCKAQGFTEDTIVFLPQTDKCMTEQ
Sequence Info	Full Length
Tag	N-terminal 6xHis-SUMO-tagged
Theoretical MW	34.69kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/27/2024

Express Delivery: Save 25 days

Compare

Add to wishlist

Recommend by mail