« Back
Home /
Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1)

Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1)

Item no.	BM-RPC25046-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Fungus
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Estimated Turnaround Time	5-7 weeks
UniProt ID	P79085
Gene Name	ALTA1
Alternative Names	Allergen: Alt a 1
Source	Yeast
Expression Region	19-157aa
AA Sequence	APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGT YYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYS CGENSFMDFSFDSDRSGLLLKQKVSDDITYVATAT LPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
Sequence Info	Full Length
Tag	N-terminal 6x His Tag
Theoretical MW	17.2 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 21 days

Compare

Add to wishlist

Recommend by mail