« Back
Home /
Recombinant human CD59 glyco protein (OPCA01221)

Recombinant human CD59 glyco protein (OPCA01221)

Item no.	OPCA01221
Manufacturer	AVIVA Systems Biology
Amount	10ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Peptide sequence	LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCN FNEQLEN
Reconstitution and storage	Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Description of target	Recombinant human CD59 glycoprotein
Purity	>90% (SDS-PAGE)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail