« Back
Home /
GJA3 Antibody - N-terminal region (OABB02079)

GJA3 Antibody - N-terminal region (OABB02079)

Item no.	OABB02079
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB
Specific against	other
Host	Rabbit
Isotype	IgG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Gene symbol	GJA3
Product format	Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Gene id	2700
Reconstitution and storage	Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Description of target	Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
Purification	Immunogen affinity purified.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/27/2024