« Back
Home /
Anti-MANBA Antibody

Anti-MANBA Antibody

Item no.	ANTI-A87731-50
Manufacturer	Antibodies.com
Amount	50ul
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Liquid
Applications	WB, IHC
Specific against	Human, Mouse
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	AAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIESTFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Product Description	Rabbit polyclonal antibody to MANBA.
Clonality	Polyclonal
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-300 of human MANBA (NP_005899.3).
Product form	Liquid
Molecular weight	101 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:200-1:2, 000, IHC: 1:50-1:200
Target	MANBA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 9/6/2024

Express Delivery: Save 10 days

Compare

Add to wishlist

Recommend by mail