« Back
Home /
Anti-GSTM5 Antibody

Anti-GSTM5 Antibody

Item no.	ANTI-A87628-200
Manufacturer	Antibodies.com
Amount	200ul
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Applications	WB
Specific against	Mouse, Rat
Host	Rabbit
Isotype	IgG
Sequence	LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Product Description	Rabbit polyclonal antibody to GSTM5.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2).
Molecular weight	24 - 26kDa (Observed MW)
Formulation	Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2000
Target	GSTM5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail