« Back
Home /
Anti-CD254 Antibody [C01-2D2]

Anti-CD254 Antibody [C01-2D2]

Item no.	ANTI-A279927-100
Manufacturer	Antibodies.com
Amount	100ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Liquid
Applications	ELISA
Clone	C01-2D2
Specific against	Human
Host	Mouse
Isotype	IgG2b
Conjugate/Tag	Unconjugated
Sequence	EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Specificity	This antibody recognises CD254 also known as RANKL and TNFSF11. CD254 is a ~20 kDa glycoprotein, a member of the tumour necrosis factor (TNF) superfamily. CD254 is a ligand for the receptor activator of NF?B (RANK) and this interaction plays a role in ost
Product Description	Mouse monoclonal [C01-2D2] antibody to RANKL.
Clonality	Monoclonal
Immunogen	E. coli derived recombinant protein corresponding to amino acids 143-317 of human CD254.
Concentration	1 mg/ml
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.
Protein Length	175
Amino acids	aa 143 - 317
Purification	Protein G affinity chromatography of ascites.
Storage	Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
Target	RANKL

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail