« Back
Home /
Anti-SARS-CoV Nucleoprotein Antibody [3851]

Anti-SARS-CoV Nucleoprotein Antibody [3851]

Item no.	ANTI-A278810-100
Manufacturer	Antibodies.com
Amount	100ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Liquid
Applications	WB, ELISA
Clone	3851
Specific against	Viral
Host	Mouse
Isotype	IgG2b
Conjugate/Tag	Unconjugated
Sequence	MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Specificity	This antibody recognises nucleoprotein, also known as nucleocapsid protein and Protein N. The nucleoprotein (N) is the most abundant viral protein in SARS-CoV-infected cells. It is one of the four structural proteins essential for viral assembly, alongsid
Product Description	Mouse monoclonal [3851] antibody to SARS-CoV Nucleoprotein.
Clonality	Monoclonal
Reactivity	Viral
Immunogen	Recombinant fragment amino acids 1-49 of the SARS nucleoprotein.
Concentration	1 mg/ml
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.
Protein Length	49
Amino acids	aa 1 - 49
Purification	Protein A affinity chromatography.
Storage	Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
Recommended dilutions	ELISA: 1 µg/ml, WB: 1 µg/ml
Target	SARS-CoV Nucleoprotein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 9/6/2024

Express Delivery: Save 10 days

Compare

Add to wishlist

Recommend by mail