« Back
Home /
SUR1 and SUR2B Antibody

SUR1 and SUR2B Antibody

Manufacturer	Abcepta
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Specific against	other
Format	RPE
Amount	Inquiry
Item no.	ABC-ASM10266-RPE-100
eClass 6.1	32160702
eClass 9.0	32160702
Available
Primary Accession	Q63563
Reactivity	M, Rat
Legend image 1	Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR1 and SUR2B Monoclonal Antibody, Clone S323A-31 (ASM10266). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SUR1 and SUR2B Monoclonal Antibody (ASM10266) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) SUR1 and SUR2B Antibody (D) Composite.
Type image 1	ICC/IF
Dilution image 1	1:100
Legend image 2	Western Blot analysis of Rat Brain Membrane showing detection of ~174 kDa SUR1/SUR2B protein using Mouse Anti-SUR1/SUR2B Monoclonal Antibody, Clone S323A-31 (ASM10266). Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 µg). . Load: 10 µg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR1/SUR2B Monoclonal Antibody (ASM10266) at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~174 kDa. Other Band(s): ~75 kDa.
Type image 2	WB
Dilution image 2	1:1000
Other Accession	NP_037172.2
Isotype	IgG1
Target/Specificity	Detects ~175kDa and smaller fragments likely due to proteolytic cleavage.
Immunogen	Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B
Purification	Protein G Purified
Reconstitution & Storage	-20ºC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ASM10266-RPE-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: Inquiry

available

Delivery expected until 9/6/2024

Express Delivery: Save 28 days

Compare

Add to wishlist

Recommend by mail