Comparison

Anti-Six3 Picoband Antibody

Item no. ABC-ABO12988
Manufacturer Abcepta
Amount 100 ug
Category
Type Antibody Primary
Format Lyophilized
Applications WB
Specific against other
Host Rabbit
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Similar products SIX3, Homeobox protein SIX3, Sine oculis homeobox homolog 3
Available
Primary Accession
O95343
Application
WB
Clonality
Polyclonal
Gene ID
6496
Reactivity
H, M, Rat
Legend image 1
Figure 1. Western blot analysis of Six3 using anti-Six3 antibody (ABO12988).
Type image 1
WB
Dilution image 1
0.1-0.5 µg/ml
Calculated MW
35487
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description
Rabbit IgG polyclonal antibody for Homeobox protein SIX3(SIX3) detection. Tested with WB in Human; Mouse; Rat.
Protein Function
Transcriptional regulator which can act as both a transcriptional repressor and activator by binding a ATTA homeodomain core recognition sequence on these target genes. During forebrain development represses WNT1 expression allowing zona limitans intrathalamica formation and thereby ensuring proper anterio-posterior patterning of the diencephalon and formation of the rostral diencephalon. Acts as a direct upstream activator of SHH expression in the rostral diencephalon ventral midline and that in turn SHH maintains its expression. In addition, Six3 activity is required for the formation of the telencephalon. During postnatal stages of brain development is necessary for ependymal cell maturation by promoting the maturation of radial glia into ependymal cells through regulation of neuroblast proliferation and migration. Acts on the proliferation and differentiation of neural progenitor cells through activating transcription of CCND1 AND CCND2. During early lens formation plays a role in lens induction and specification by activating directly PAX6 in the presumptive lens ectoderm. In turn PAX6 activates SIX3 resulting in activation of PDGFRA and CCND1 promoting cell proliferation. Also is required for the neuroretina development by directly suppressing WNT8B expression in the anterior neural plate territory. Its action during retina development and lens morphogenesis is AES and TLE4-dependent manner. Furthermore, during eye development regulates several genes expression. Before and during early lens development represses the CRYGF promoter by binding a SIX repressor element. Directly activates RHO transcription, or cooperates with CRX or NRL. Six3 functions also in the formation of the proximodistal axis of the optic cup, and promotes the formation of optic vesicles-like structures. During pituitary development, acts in parallel or alternatively with HESX1 to control cell proliferation through Wnt/beta-catenin pathway (By similarity). Plays a role in eye development by suppressing WNT1 expression and in dorsal- ventral patterning by repressing BMP signaling pathway. .
Subcellular Localization
Nucleus .
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Six3 (1-32aa MVFRSPLDLYSSHFLLPNFADSHHRSILLASS), different from the related mouse sequence by two amino acids.
Purification
Immunogen affinity purified.
Cross Reactivity
No cross reactivity with other proteins.
Storage
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Concentration (mg/ml)
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close