« Back
Home /
Anti-CD46 Picoband Antibody

Anti-CD46 Picoband Antibody

Item no.	ABC-ABO12534
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	CD46, Cd46, Membrane cofactor protein, Mcp
Available
Primary Accession	O88174
Application	WB
Clonality	Polyclonal
Gene ID	17221
Reactivity	M
Legend image 1	Western blot analysis of CD46 expression in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). CD46 at 41KD, 70KD was detected using rabbit anti- CD46 Antigen Affinity purified polyclonal antibody (Catalog # ABO12534) at0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	40881
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Membrane cofactor protein(CD46) detection. Tested with WB in Mouse.
Protein Function	May be involved in the fusion of the spermatozoa with the oocyte during fertilization. .
Subcellular Localization	Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Inner acrosomal membrane of spermatozoa.
Tissue Specificity	Present only in testis (at protein level). .
Protein Name	Membrane cofactor protein
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12534-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/8/2024

Express Delivery: Save 29 days

Compare

Add to wishlist

Recommend by mail